General Information

  • ID:  hor006631
  • Uniprot ID:  P43306
  • Protein name:  Progonadoliberin-2
  • Gene name:  gnrh2
  • Organism:  Clarias gariepinus (North African catfish) (Silurus gariepinus)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Clarias (genus), Clariidae (family), Siluroidei (suborder), Siluriformes (order), Characiphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGWYPGGKREIDSYSSPEISGEIKLCEAGECSYLRPLRTNILKSILIDTLARKFQKRK
  • Length:  62
  • Propeptide:  MVSVCRLLLVAALLLCLQAQLSFSQHWSHGWYPGGKREIDSYSSPEISGEIKLCEAGECSYLRPLRTNILKSILIDTLARKFQKRK
  • Signal peptide:  MVSVCRLLLVAALLLCLQAQLSFS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P43306-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006631_AF2.pdbhor006631_ESM.pdb

Physical Information

Mass: 828046 Formula: C321H508N92O92S2
Absent amino acids: MV Common amino acids: SIKL
pI: 9.66 Basic residues: 13
Polar residues: 20 Hydrophobic residues: 17
Hydrophobicity: -73.55 Boman Index: -13823
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 78.71
Instability Index: 6655.97 Extinction Coefficient cystines: 15595
Absorbance 280nm: 255.66

Literature

  • PubMed ID:  8020492
  • Title:  Isolation, characterization and expression of cDNAs encoding the catfish-type and chicken-II-type gonadotropin-releasing-hormone precursors in the African catfish.
  • PubMed ID:  1520292
  • Title:  Two gonadotropin-releasing hormones from African catfish (Clarias gariepinus).